6dm4/2/1:C/1:D

Sequences
>6dm4-a2-m1-cC (length=119) [Search sequence]
SEKIYKVMEEIFVDRHYKENIRTGEEVKQYFSKSKAEFILRWSSANESDTENKYVFIAAS
FQASDGIHSIRYGINKNGELFSINTASNKVTPIDILPLGVMATLTQHITQNKELIEKAL
>6dm4-a2-m1-cD (length=119) [Search sequence]
SEKIYKVMEEIFVDRHYKENIRTGEEVKQYFSKSKAEFILRWSSANESDTENKYVFIAAS
FQASDGIHSIRYGINKNGELFSINTASNKVTPIDILPLGVMATLTQHITQNKELIEKAL
Structure information
PDB ID 6dm4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the SH2 domain from RavO (Lpg1129) from Legionella pneumophila in complex with Homo sapiens Shc1 phospho-Tyr317 peptide
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q5ZWF6 Q5ZWF6
Species 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1) 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)
Function annotation BioLiP:6dm4C BioLiP:6dm4D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6dm4-a2-m1-cC_6dm4-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6dm4-assembly2.cif.gz
Similar dimers

[Back to Home]