6hk5/2/1:C/1:B

Sequences

>6hk5-a2-m1-cC (length=61) [Search sequence]

ERGRKRLGIYLAHFLDHVEGHGEIGVQRDALAEDARLGALIDRALADAVARASLNAVLRD L

>6hk5-a2-m1-cB (length=64) [Search sequence]

ESPERGRKRLGIYLAHFLDHVEGHGEIGVQRDALAEDARLGALIDRALADAVARASLNAV LRDL

Structure information

PDB ID	6hk5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray structure of a truncated mutant of the metallochaperone CooJ with a high-affinity nickel-binding site
Assembly ID	2
Resolution	2.042Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	91
Sequence identity between the two chains	1.0
PubMed citation	30858174

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	P72321	P72321
Species	1085 (Rhodospirillum rubrum)	1085 (Rhodospirillum rubrum)
Function annotation	BioLiP:6hk5C	BioLiP:6hk5B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6hk5-a2-m1-cC_6hk5-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6hk5-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6hk5/1/1:C/1:B 6hk5/1/1:E/1:G 6hk5/3/1:E/1:G 6hk5/4/1:D/1:A 6hk5/4/1:H/1:F 6hk5/5/1:D/1:A 6hk5/6/1:H/1:F
Other dimers with similar sequences but different poses	6hk5/4/1:F/1:D 6hk5/1/1:C/1:G