6j3z/1/1:M/1:m

Sequences

>6j3z-a1-m1-cM (length=42) [Search sequence]

EVQFGAYLAVLLGTFLPALFLVNLFIQTEARKAGKAGGQDSD

>6j3z-a1-m1-cm (length=42) [Search sequence]

EVQFGAYLAVLLGTFLPALFLVNLFIQTEARKAGKAGGQDSD

Structure information

PDB ID	6j3z (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of C2S1M1-type PSII-FCPII supercomplex from diatom
Assembly ID	1
Resolution	3.6Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	67
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	M	m
UniProt accession
Species	184592 (Chaetoceros gracilis)	184592 (Chaetoceros gracilis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6j3z-a1-m1-cM_6j3z-a1-m1-cm.pdb.gz

Full biological assembly Download: 6j3z-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6j3y/1/1:M/1:m 6j40/1/1:M/1:m 6jlu/1/1:M/1:m 7vd5/1/1:M/1:m