6lb3/3/1:D/1:C

Sequences

>6lb3-a3-m1-cD (length=92) [Search sequence]

MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFDT SAQFWMNLQSEYSLATAYAANGKQIEHEIEPL

>6lb3-a3-m1-cC (length=93) [Search sequence]

GMRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFD TSAQFWMNLQSEYSLATAYAANGKQIEHEIEPL

Structure information

PDB ID	6lb3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of PA4674 in complex with its operator DNA (18bp) from Pseudomonas aeruginosa
Assembly ID	3
Resolution	2.497Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	91
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q9HVC1	Q9HVC1
Species	208964 (Pseudomonas aeruginosa PAO1)	208964 (Pseudomonas aeruginosa PAO1)
Function annotation	BioLiP:6lb3D	BioLiP:6lb3C

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6lb3-a3-m1-cD_6lb3-a3-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6lb3-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6jpi/1/1:A/1:B 6jpi/1/1:C/1:D 6lb3/2/1:A/1:B 6lb3/2/1:G/1:H 6lb3/3/1:E/1:F 7csv/1/1:B/1:A 7csw/1/1:A/1:B 7csy/1/1:A/1:B 7csy/1/1:C/1:D