6mm2/1/2:A/3:A

Sequences

>6mm2-a1-m2-cA (length=99) [Search sequence]

SSQQVWKLVIITEEILLKKVSKIIKEAGASGYTVLAAAGEGSRNVRSTGEPSVSHAYSNI KFEVLTASRELADQIQDKVVAKYFDDYSCITYISTVEAL

>6mm2-a1-m3-cA (length=99) [Search sequence]

SSQQVWKLVIITEEILLKKVSKIIKEAGASGYTVLAAAGEGSRNVRSTGEPSVSHAYSNI KFEVLTASRELADQIQDKVVAKYFDDYSCITYISTVEAL

Structure information

PDB ID	6mm2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Carbon regulatory PII-like protein SbtB from Cyanobium sp. 7001 bound to ATP and calcium
Assembly ID	1
Resolution	1.04Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	48
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	A	A
UniProt accession	B5II98	B5II98
Species	180281 (Cyanobium sp. PCC 7001)	180281 (Cyanobium sp. PCC 7001)
Function annotation	BioLiP:6mm2A	BioLiP:6mm2A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6mm2-a1-m2-cA_6mm2-a1-m3-cA.pdb.gz

Full biological assembly Download: 6mm2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6mm2/1/1:A/2:A 6mm2/1/1:A/3:A 6ntb/1/1:A/1:B 6ntb/1/1:A/1:C