6mm2/1/2:A/3:A

Sequences
>6mm2-a1-m2-cA (length=99) [Search sequence]
SSQQVWKLVIITEEILLKKVSKIIKEAGASGYTVLAAAGEGSRNVRSTGEPSVSHAYSNI
KFEVLTASRELADQIQDKVVAKYFDDYSCITYISTVEAL
>6mm2-a1-m3-cA (length=99) [Search sequence]
SSQQVWKLVIITEEILLKKVSKIIKEAGASGYTVLAAAGEGSRNVRSTGEPSVSHAYSNI
KFEVLTASRELADQIQDKVVAKYFDDYSCITYISTVEAL
Structure information
PDB ID 6mm2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Carbon regulatory PII-like protein SbtB from Cyanobium sp. 7001 bound to ATP and calcium
Assembly ID 1
Resolution 1.04Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession B5II98 B5II98
Species 180281 (Cyanobium sp. PCC 7001) 180281 (Cyanobium sp. PCC 7001)
Function annotation BioLiP:6mm2A BioLiP:6mm2A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6mm2-a1-m2-cA_6mm2-a1-m3-cA.pdb.gz
Full biological assembly
Download: 6mm2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6mm2/1/1:A/2:A 6mm2/1/1:A/3:A 6ntb/1/1:A/1:B 6ntb/1/1:A/1:C

[Back to Home]