6od5/1/1:B/1:A

Sequences

>6od5-a1-m1-cB (length=60) [Search sequence]

MRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRE

>6od5-a1-m1-cA (length=62) [Search sequence]

HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVR ER

Structure information

PDB ID	6od5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Human TCF4 C-terminal bHLH domain in Complex with 12-bp Oligonucleotide Containing E-box Sequence with 5-carboxylcytosines
Assembly ID	1
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	61
Sequence identity between the two chains	1.0
PubMed citation	31081034

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P15884	P15884
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6od5B	BioLiP:6od5A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6od5-a1-m1-cB_6od5-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6od5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6od3/1/1:B/1:A 6od3/2/1:F/1:E 6od4/1/1:A/1:B 6od4/2/1:G/1:H 6od5/2/1:C/1:D
Other dimers with similar sequences but different poses	6od3/4/1:J/1:I 6od3/3/1:G/1:H