6pcf/1/2:C/2:B

Sequences

>6pcf-a1-m2-cC (length=56) [Search sequence]

QVCCGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKF

>6pcf-a1-m2-cB (length=65) [Search sequence]

APSMKERQVCCGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFK EKFEA

Structure information

PDB ID	6pcf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Human Coa6: W59C mutant protein
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	C	B
UniProt accession	Q5JTJ3	Q5JTJ3
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6pcf-a1-m2-cC_6pcf-a1-m2-cB.pdb.gz

Full biological assembly Download: 6pcf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

6pcf/1/2:C/1:D 6pcf/1/1:A/2:B