6scf/2/1:G/1:B

Sequences

>6scf-a2-m1-cG (length=112) [Search sequence]

NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTT FQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIV

>6scf-a2-m1-cB (length=113) [Search sequence]

NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTT FQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD

Structure information

PDB ID	6scf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate
Assembly ID	2
Resolution	1.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	86
Sequence identity between the two chains	1.0
PubMed citation	31942067

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	B
UniProt accession	Q8QL27	Q8QL27
Species	157898 (Sulfolobus islandicus rod-shaped virus 1)	157898 (Sulfolobus islandicus rod-shaped virus 1)
Function annotation	BioLiP:6scfG	BioLiP:6scfB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6scf-a2-m1-cG_6scf-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6scf-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2x4i/2/1:B/1:A 6scf/1/2:H/1:A 6scf/3/1:C/1:E 6scf/4/1:D/1:F