6sq2/1/1:D/1:E

Sequences

>6sq2-a1-m1-cD (length=31) [Search sequence]

NRPRFTLQELRDVLQERNKLKSQLLVVQEEL

>6sq2-a1-m1-cE (length=32) [Search sequence]

NRPRFTLQELRDVLQERNKLKSQLLVVQEELQ

Structure information

PDB ID	6sq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a phosphomimetic switch 2 variant of Rab8a in complex with the phospho-Rab binding domain of RILPL2
Assembly ID	1
Resolution	1.684Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	Q969X0	Q969X0
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6sq2-a1-m1-cD_6sq2-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6sq2-assembly1.cif.gz

Similar dimers