6wix/1/2:B/3:B

Sequences

>6wix-a1-m2-cB (length=120) [Search sequence]

AVFLGFLGAAGSTMGAASNQHLLKLTVWGIKQLQARVLAVERYLEVQQLLGIWGCSGKLI CCTNVPWNSSWSNKSLDEIWNNMTWLQWDKEINNYTQLIYRLIEESQFQQEINEVELLAL

>6wix-a1-m3-cB (length=120) [Search sequence]

AVFLGFLGAAGSTMGAASNQHLLKLTVWGIKQLQARVLAVERYLEVQQLLGIWGCSGKLI CCTNVPWNSSWSNKSLDEIWNNMTWLQWDKEINNYTQLIYRLIEESQFQQEINEVELLAL

Structure information

PDB ID	6wix (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of HIV-1 MI369 RnS-DS.SOSIP Prefusion Env Trimer in Complex with Human Antibodies 3H109L and 35O22 at 3.5 Angstrom
Assembly ID	1
Resolution	2.67Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	B	B
UniProt accession	O55774	O55774
Species	11676 (Human immunodeficiency virus 1)	11676 (Human immunodeficiency virus 1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6wix-a1-m2-cB_6wix-a1-m3-cB.pdb.gz

Full biological assembly Download: 6wix-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6wix/1/1:B/2:B 6wix/1/1:B/3:B 7llk/1/1:B/1:F 7llk/1/1:B/1:J 7llk/1/1:F/1:J