6xyd/1/1:A/1:C

Sequences

>6xyd-a1-m1-cA (length=106) [Search sequence]

HMPNLCVSATFNPPVITMLGSALREETVKLLEQRIPTGVSVKFLFYPNPDHWRMELSQHF DDLHKSAVFLTIIEGLEGEGWNLRASNSIRDSESGKDTTKLFFARR

>6xyd-a1-m1-cC (length=106) [Search sequence]

GSHMPNLCVSATFNPPVITMLGSALREETVKLLEQRIPTGVKFLFYPNPDHWRMELSQHF DDLHKSAVFLTIIEGLEGEGWNLRASNSIRDSESGKDTTKLFFARR

Structure information

PDB ID	6xyd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Q4D6Q6, a conserved kinetoplastid-specific protein from Trypanosoma cruzi
Assembly ID	1
Resolution	1.81Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	0.981

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	Q4D6Q6	Q4D6Q6
Species	353153 (Trypanosoma cruzi strain CL Brener)	353153 (Trypanosoma cruzi strain CL Brener)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6xyd-a1-m1-cA_6xyd-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6xyd-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6xyb/1/1:A/1:C 6xyb/1/1:B/1:A 6xyb/1/1:B/1:D 6xyb/1/1:D/1:C 6xyd/1/1:B/1:C 6xyd/1/1:D/1:A 6xyd/1/1:D/1:B