6zif/1/1:D/1:C

Sequences
>6zif-a1-m1-cD (length=107) [Search sequence]
SKEMQSCVDECLRCYQMCFGMAMTHCLETGGDHVKPKHFRAMISCAEMCRNAAHMMLMKS
PQARHICEDCAEACEACAKECDALPDMKDCAAQCRRCAEACRKMAGQ
>6zif-a1-m1-cC (length=108) [Search sequence]
SKEMQSCVDECLRCYQMCFGMAMTHCLETGGDHVKPKHFRAMISCAEMCRNAAHMMLMKS
PQARHICEDCAEACEACAKECDALPDMKDCAAQCRRCAEACRKMAGQK
Structure information
PDB ID 6zif (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of a cytosolic copper storage protein from Methylocystis sp. Strain Rockwell (ATCC 49242)
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession
Species 622637 (Methylocystis sp. ATCC 49242) 622637 (Methylocystis sp. ATCC 49242)
Function annotation BioLiP:6zifD BioLiP:6zifC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6zif-a1-m1-cD_6zif-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6zif-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6zif/1/1:B/1:D 6zif/1/1:A/1:C
  • 6zif/1/1:D/1:A 6zif/1/1:B/1:C
  • [Back to Home]