7dn4/1/1:C/1:F

Sequences

>7dn4-a1-m1-cC (length=118) [Search sequence]

DAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEE RVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSH

>7dn4-a1-m1-cF (length=118) [Search sequence]

DAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEE RVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSH

Structure information

PDB ID	7dn4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of Cpd8 in complex with BPTF bromodomain
Assembly ID	1
Resolution	2.841Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	25
Sequence identity between the two chains	1.0
PubMed citation	33548625

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	F
UniProt accession	Q12830	Q12830
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7dn4C	BioLiP:7dn4F

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7dn4-a1-m1-cC_7dn4-a1-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7dn4-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7dn4/1/1:A/1:D 7dn4/1/1:B/1:E
Other dimers with similar sequences but different poses	2f6n/1/1:B/1:A 2f6j/1/1:C/1:B 7dn4/1/1:E/1:F 7dn4/1/1:B/1:C