7dsg/1/2:A/4:A

Sequences

>7dsg-a1-m2-cA (length=88) [Search sequence]

PIERVDYICERSVVVPVTYIRSNGAPAAAVLEVEGKMVALQWHGDLKKYVAIDEQDSYRW ADRGGQATLSHLEADHTAKEVTLLSACR

>7dsg-a1-m4-cA (length=88) [Search sequence]

PIERVDYICERSVVVPVTYIRSNGAPAAAVLEVEGKMVALQWHGDLKKYVAIDEQDSYRW ADRGGQATLSHLEADHTAKEVTLLSACR

Structure information

PDB ID	7dsg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Brucella abortus PhiA
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	48
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	4
Chain ID	A	A
UniProt accession	Q57FR6	Q57FR6
Species	262698 (Brucella abortus bv. 1 str. 9-941)	262698 (Brucella abortus bv. 1 str. 9-941)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7dsg-a1-m2-cA_7dsg-a1-m4-cA.pdb.gz

Full biological assembly Download: 7dsg-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7dpy/1/1:A/2:A 7dpy/1/1:B/2:B 7dsg/1/1:A/3:A
Other dimers with similar sequences but different poses	7dsg/1/3:A/4:A 7dsg/1/1:A/2:A