7dsg/1/2:A/4:A

Sequences
>7dsg-a1-m2-cA (length=88) [Search sequence]
PIERVDYICERSVVVPVTYIRSNGAPAAAVLEVEGKMVALQWHGDLKKYVAIDEQDSYRW
ADRGGQATLSHLEADHTAKEVTLLSACR
>7dsg-a1-m4-cA (length=88) [Search sequence]
PIERVDYICERSVVVPVTYIRSNGAPAAAVLEVEGKMVALQWHGDLKKYVAIDEQDSYRW
ADRGGQATLSHLEADHTAKEVTLLSACR
Structure information
PDB ID 7dsg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Brucella abortus PhiA
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession Q57FR6 Q57FR6
Species 262698 (Brucella abortus bv. 1 str. 9-941) 262698 (Brucella abortus bv. 1 str. 9-941)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7dsg-a1-m2-cA_7dsg-a1-m4-cA.pdb.gz
Full biological assembly
Download: 7dsg-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7dpy/1/1:A/2:A 7dpy/1/1:B/2:B 7dsg/1/1:A/3:A
Other dimers with similar sequences but different poses
  • 7dsg/1/3:A/4:A 7dsg/1/1:A/2:A
  • [Back to Home]