7evp/1/1:C/1:D

Sequences

>7evp-a1-m1-cC (length=43) [Search sequence]

LSYYRGGHKDLESMFELALEYIEKLEEEDEQQVTDYENAMEEE

>7evp-a1-m1-cD (length=43) [Search sequence]

LSYYRGGHKDLESMFELALEYIEKLEEEDEQQVTDYENAMEEE

Structure information

PDB ID	7evp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of the Gp168-beta-clamp complex
Assembly ID	1
Resolution	3.2Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q4Z971	Q4Z971
Species	55510 (Twortvirus twort)	55510 (Twortvirus twort)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7evp-a1-m1-cC_7evp-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7evp-assembly1.cif.gz