7nb0/2/1:D/1:B

Sequences

>7nb0-a2-m1-cD (length=55) [Search sequence]

VTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKC

>7nb0-a2-m1-cB (length=57) [Search sequence]

QVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCN

Structure information

PDB ID	7nb0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the DNA-binding domain of SEPALLATA 3
Assembly ID	2
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	98
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	O22456	O22456
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7nb0-a2-m1-cD_7nb0-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7nb0-assembly2.cif.gz

Similar dimers