7nx5/1/1:B/1:A

Sequences

>7nx5-a1-m1-cB (length=61) [Search sequence]

EIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTP D

>7nx5-a1-m1-cA (length=62) [Search sequence]

MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPR TP

Structure information

PDB ID	7nx5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Epstein-Barr Virus protein ZEBRA (BZLF1, Zta) bound to a methylated DNA duplex
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	76
Sequence identity between the two chains	0.984
PubMed citation	34893887

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P03206	P03206
Species	10377 (Human herpesvirus 4 strain B95-8)	10377 (Human herpesvirus 4 strain B95-8)
Function annotation	BioLiP:7nx5B	BioLiP:7nx5A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7nx5-a1-m1-cB_7nx5-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7nx5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2c9l/1/1:Z/1:Y 2c9n/1/1:Y/1:Z 5szx/1/1:A/1:B 7nx5/2/1:E/1:F