7r31/1/1:A/1:B

Sequences

>7r31-a1-m1-cA (length=99) [Search sequence]

KPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGSRNVRSSGQPNTSDIEANIKF EILTETREMAEEIADRVAVKYFNDYAGIIYICSAEVLYG

>7r31-a1-m1-cB (length=100) [Search sequence]

KPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGSRNVRSSGQPNTSDIEANIKF EILTETREMAEEIADRVAVKYFNDYAGIIYICSAEVLYGH

Structure information

PDB ID	7r31 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Carbon regulatory PII-like protein SbtB from Synechocystis sp. 6803, C105A+C110A variant, in complex with ATP (co-crystal), tetragonal crystal form
Assembly ID	1
Resolution	1.52Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	75
Sequence identity between the two chains	1.0
PubMed citation	36800386

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P73954	P73954
Species	1148 (Synechocystis sp. PCC 6803)	1148 (Synechocystis sp. PCC 6803)
Function annotation	BioLiP:7r31A	BioLiP:7r31B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7r31-a1-m1-cA_7r31-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7r31-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7cyf/1/1:D/1:E 7cyf/1/1:D/1:F 7cyf/1/1:E/1:F 7egk/1/1:B/1:D 7egk/1/1:B/1:F 7egk/1/1:D/1:F 7r32/1/1:C/1:B