7sax/1/1:G/1:C

Sequences

>7sax-a1-m1-cG (length=50) [Search sequence]

FGINTLINWGATVVIIGLMFKILHLKGGEWMIGVGLAVEALLFFIMGFMQ

>7sax-a1-m1-cC (length=60) [Search sequence]

FGINTLINWGATVVIIGLMFKILHLKGGEWMIGVGLAVEALLFFIMGFMQAEQEPDWTRV

Structure information

PDB ID	7sax (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of GldLM, the proton-powered motor that drives Type IX protein secretion and gliding motility in Sphingobacterium wenxiniae
Assembly ID	1
Resolution	3.0Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	C
UniProt accession	A0A1I6R6J4	A0A1I6R6J4
Species	683125 (Sphingobacterium wenxiniae)	683125 (Sphingobacterium wenxiniae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7sax-a1-m1-cG_7sax-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7sax-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7sax/1/1:E/1:D 7sax/1/1:E/1:F 7sax/1/1:F/1:G