7vp2/1/1:B/1:A

Sequences
>7vp2-a1-m1-cB (length=58) [Search sequence]
KDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKTAIDKL
>7vp2-a1-m1-cA (length=83) [Search sequence]
LKGYSVGGGEIVEVQGGHIIRATGRKDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRL
GYDRPSKAVDWLIKKAKTAIDKL
Structure information
PDB ID 7vp2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a transcription factor and DNA complex
Assembly ID 1
Resolution 1.92Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 133
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession O82277 O82277
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:7vp2B BioLiP:7vp2A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7vp2-a1-m1-cB_7vp2-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7vp2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7vp1/1/1:B/1:A 7vp4/1/1:B/1:A 7vp4/2/1:F/1:E 7vp4/3/1:I/1:J 7vp5/1/1:A/1:B 7vp5/2/1:E/1:F 7vp7/1/1:B/1:A

[Back to Home]