7yr6/1/1:D/1:E

Sequences

>7yr6-a1-m1-cD (length=55) [Search sequence]

MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEK

>7yr6-a1-m1-cE (length=55) [Search sequence]

MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEK

Structure information

PDB ID	7yr6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of Pseudomonas aeruginosa RsmZ RNA in complex with two RsmA protein dimers
Assembly ID	1
Resolution	4.8Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	102
Sequence identity between the two chains	1.0
PubMed citation	36828938

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	V6AK05	V6AK05
Species	287 (Pseudomonas aeruginosa)	287 (Pseudomonas aeruginosa)
Function annotation	BioLiP:7yr6D	BioLiP:7yr6E

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7yr6-a1-m1-cD_7yr6-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7yr6-assembly1.cif.gz