7yr6/1/1:D/1:E

Sequences
>7yr6-a1-m1-cD (length=55) [Search sequence]
MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEK
>7yr6-a1-m1-cE (length=55) [Search sequence]
MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEK
Structure information
PDB ID 7yr6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cryo-EM structure of Pseudomonas aeruginosa RsmZ RNA in complex with two RsmA protein dimers
Assembly ID 1
Resolution 4.8Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 102
Sequence identity between the two chains 1.0
PubMed citation 36828938
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession V6AK05 V6AK05
Species 287 (Pseudomonas aeruginosa) 287 (Pseudomonas aeruginosa)
Function annotation BioLiP:7yr6D BioLiP:7yr6E
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7yr6-a1-m1-cD_7yr6-a1-m1-cE.pdb.gz
Full biological assembly
Download: 7yr6-assembly1.cif.gz

[Back to Home]