7yrt/5/1:I/1:G

Sequences

>7yrt-a5-m1-cI (length=114) [Search sequence]

QHSHLDSLEDQVERYKQVLDVMPAGVILLDTQGIVREANPEAQRLLDVPLVGEKWYSVIQ IAFAPRDDDGHEISLRNGRKVRLAISASTTGQLILITDLTETRLLQSRISDLQR

>7yrt-a5-m1-cG (length=115) [Search sequence]

QHSHLDSLEDQVERYKQVLDVMPAGVILLDTQGIVREANPEAQRLLDVPLVGEKWYSVIQ IAFAPRDDDGHEISLRNGRKVRLAISASTTGQLILITDLTETRLLQSRISDLQRL

Structure information

PDB ID	7yrt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of PAS like domain of FlrB, the histidine kinase involved in flagellar synthesis of Vibrio cholerae
Assembly ID	5
Resolution	2.27Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	140
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	I	G
UniProt accession	H9L4P6	H9L4P6
Species	127906 (Vibrio cholerae O1)	127906 (Vibrio cholerae O1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7yrt-a5-m1-cI_7yrt-a5-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7yrt-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7yrt/1/1:A/1:E 7yrt/2/1:B/1:F 7yrt/3/1:K/1:C 7yrt/4/1:L/1:D 7yrt/6/1:J/1:H