7zc3/1/1:A/1:B

Sequences

>7zc3-a1-m1-cA (length=67) [Search sequence]

PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKT VSYLGLE

>7zc3-a1-m1-cB (length=67) [Search sequence]

PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKT VSYLGLE

Structure information

PDB ID	7zc3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human copper chaperone Atox1 bound to zinc ion by CxxC motif
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	46
Sequence identity between the two chains	1.0
PubMed citation	36291703

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O00244	O00244
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7zc3A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7zc3-a1-m1-cA_7zc3-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7zc3-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1fe0/1/1:A/1:B 1fe4/1/1:A/1:B 1fee/1/1:A/1:B 3iwx/1/1:A/1:B 4qot/1/1:A/1:B 4yea/1/1:A/1:B