8h8r/1/1:H/1:U

Sequences

>8h8r-a1-m1-cH (length=75) [Search sequence]

YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVS TWDDRRAEGTFPGKI

>8h8r-a1-m1-cU (length=75) [Search sequence]

YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVS TWDDRRAEGTFPGKI

Structure information

PDB ID	8h8r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Bovine Heart Cytochrome c Oxidase in the Calcium-bound Fully Oxidized State
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0
PubMed citation	36708913

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	U
UniProt accession	P00429	P00429
Species	9913 (Bos taurus)	9913 (Bos taurus)
Function annotation	BioLiP:8h8rH	BioLiP:8h8rU

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8h8r-a1-m1-cH_8h8r-a1-m1-cU.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8h8r-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1occ/1/1:H/1:U 1oco/1/1:H/1:U 1ocr/1/1:H/1:U 1ocz/1/1:H/1:U 1v54/1/1:H/1:U 1v55/1/1:H/1:U 2dyr/1/1:H/1:U 2dys/1/1:H/1:U 2eij/1/1:H/1:U 2eik/1/1:H/1:U 2eil/1/1:H/1:U 2eim/1/1:H/1:U 2ein/1/1:H/1:U 2occ/3/1:H/1:U 5w97/1/1:H/1:h 5wau/1/1:H/1:h 6juw/1/1:H/1:U 6nkn/1/1:H/1:U 6nmf/1/1:H/1:U 6nmp/1/1:H/1:U 7cp5/1/1:H/1:U 7d5w/1/1:H/1:U 7d5x/1/1:H/1:U 7thu/1/1:H/1:U 7tie/1/1:H/1:U 7tih/1/1:H/1:U 7tii/1/1:H/1:U 8h8s/1/1:H/1:U