Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services


TM-score TM-align US-align MM-align RNA-align NW-align LS-align EDTSurf MVP MVP-Fit SPICKER HAAD PSSpred 3DRobot MR-REX I-TASSER-MR SVMSEQ NeBcon ResPRE TripletRes DeepPotential WDL-RF ATPbind DockRMSD DeepMSA FASPR EM-Refiner GPU-I-TASSER


You can:


NameGastrin-releasing peptide receptor
SpeciesMus musculus (Mouse)
BB2 receptor
Gastrin-releasing peptide receptor
GRP-preferring bombesin receptor
DiseaseN/A for non-human GPCRs
Protein Data BankN/A
GPCR-HGmod modelN/A
3D structure modelNo available structures or models
Therapeutic Target DatabaseN/A

Known ligands

You can:

Total entries: 63
Page:  / 1 

GLASS IDMoleculeFormulaMolecular weightH-bond acceptor / donorXlogPLipinski's druglikeness
74572D structureCHEMBL2111952C58H74N14O81095.3211 / 113.7No
74582D structureCHEMBL2112786C58H74N14O81095.3211 / 113.7No
149312D structureCHEMBL438279C56H71N15O81082.2812 / 122.4No
157252D structureCHEMBL2369385C42H60N12O8861.01810 / 101.4No
169052D structureCHEMBL216420C60H78N14O111171.3714 / 113.3No
173092D structureCHEMBL2369387C43H62N12O8875.04510 / 101.8No
270292D structureCHEMBL414356C57H69F3N14O81135.2614 / 114.0No
283012D structureCHEMBL2369388C46H68N12O8917.12610 / 103.1No
375482D structureCHEMBL385805C60H78N14O101155.3712 / 133.4No
557302D structureCHEMBL386993C59H74N14O81107.3311 / 113.8No
560732D structureCHEMBL2370862C61H75N15O81146.3712 / 123.8No
5535572D structureKuwanon HC45H44O11760.83611 / 89.2No
659602D structureCHEMBL415455C57H72N14O81081.2911 / 103.1No
672572D structureCHEMBL408537C57H69F3N14O81135.2614 / 114.0No
716672D structureCHEMBL386478C61H74N14O81131.3511 / 114.6No
722412D structureCHEMBL412579C58H69N15O81104.2912 / 113.6No
813462D structureCHEMBL263873C47H68N14O9S1005.2112 / 120.6No
813472D structureCHEMBL438290C47H68N14O9S1005.2112 / 120.6No
823062D structureCHEMBL439069C55H74N12O8S1063.3311 / 104.7No
998452D structureBDBM85488C57H76N14O101117.3212 / 132.5No
1049742D structureCHEMBL264648C59H76N14O81109.3511 / 114.2No
1197902D structureCHEMBL429542C58H74N14O91111.3212 / 113.3No
1245402D structureCHEMBL413488C59H70N14O81103.311 / 114.4No
1345242D structureCHEMBL265736C63H75N15O8S1202.4513 / 114.9No
1375682D structureCHEMBL386476C57H74N14O71067.3111 / 113.6No
5539912D structureRc-3095C56H79N15O91106.3412 / 142.2No
1505402D structureCHEMBL302802C44H64N12O7873.0739 / 102.6No
2035452D structureCHEMBL2112785C57H72N14O81081.2911 / 113.6No
2035462D structureCHEMBL2111953C57H72N14O81081.2911 / 113.6No
2241202D structureCHEMBL65893C42H60N12O7845.0199 / 101.7No
2279142D structureCHEMBL264122C57H72N14O91097.2912 / 123.0No
2551592D structureCHEMBL2369377C44H64N12O7873.0739 / 102.7No
2551602D structureCHEMBL294724C44H64N12O7873.0739 / 102.7No
2579282D structureCHEMBL274874C46H66N14O9S991.18312 / 120.2No
2617242D structureCHEMBL440986C49H72N14O9S1033.2612 / 122.3No
2668642D structureCHEMBL302612C48H72N12O7929.1819 / 105.3No
2673372D structureCHEMBL410783C58H72N14O81093.311 / 113.3No
2688822D structurevplpagggtvltkmyprgnhwavghlm-nh2C130H204N38O31S22859.4238 / 36-2.2No
2896302D structurePX9AZU7QPKC71H110N24O18S1619.8721 / 23-4.4No
3059222D structurePD165929C37H47N5O2593.8163 / 47.7No
3119352D structureCHEMBL266516C57H71N13O8S1098.3412 / 104.3No
3154862D structureCHEMBL383984C59H74N14O101139.3312 / 122.4No
3154872D structureCHEMBL2111954C59H74N14O101139.3312 / 122.4No
3185842D structureCHEMBL303295C43H62N12O7859.0469 / 102.1No
3185852D structureCHEMBL304469C43H62N12O7859.0469 / 102.1No
3248492D structureCHEMBL266535C58H71F3N14O81149.2914 / 114.2No
3566692D structureCHEMBL2369376C44H64N12O8889.07210 / 101.5No
3566702D structureCHEMBL2369375C44H64N12O8889.07210 / 101.5No
3718132D structureCHEMBL409598C58H74N14O81095.3211 / 114.0No
3784502D structureBombesin(7-13)C38H56N12O8808.94210 / 11-0.8No
3789662D structureCHEMBL438190C57H72N14O91097.2912 / 123.0No
3851882D structureCHEMBL264465C57H69F3N14O81135.2614 / 114.0No
3862012D structureCHEMBL267943C58H72N12O8S1097.3511 / 104.9No
3931652D structureN-Acetyl-gastrin releasing peptide ethyl esterC43H60N12O9889.02811 / 101.8No
3953352D structureCHEMBL262756C57H72N14O81081.2911 / 113.4No
3953362D structure142061-53-8C57H72N14O81081.2911 / 113.4No
4136682D structureCHEMBL2369363C41H58N12O8846.99110 / 110.2No
5553562D structureNeuromedin BC52H73N15O12S1132.3115 / 15-1.6No
4191122D structureCHEMBL265229C45H66N12O7887.19 / 103.9No
4191132D structureCHEMBL275323C45H66N12O7887.19 / 103.9No
4309472D structureCHEMBL2369384C44H64N12O8889.07210 / 102.3No
4348712D structureCHEMBL406474C46H68N12O7901.1279 / 104.5No
4356832D structureCHEMBL304177C44H64N12O7873.0739 / 102.8No

yangzhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218